BioMed Research International / 2013 / Article / Tab 2 / Research Article
Proteomic Identification of Dengue Virus Binding Proteins in Aedes aegypti Mosquitoes and Aedes albopictus Cells Table 2 Distinct host peptides identified by mass spectrometry bound to DENV.
Cell/tissue expression Protein name Experment number Peptide identified Score C6/36 (57 kDa) Enolase 1 K.EALNLIQDAIAK.A 45.6 R.GNPTVEVDLVTDLGLFR.A 62.1 K.VNQIGTVTESINAHLLAK.K 76.1 R.SGETEDTFIADLVVGLSTGQIK.T 76.1 C6/36 (67 kDa) 2 FGLDATAVGDEGGFAPNILNNKEALDLINEAISK 60.5 DS3 3 GVLKAVTQ 20.2 DMEB (67 kDa) 4 R.AAVPSGASTGVHEALELR.D 53.2 K.NLILPVPAFNVINGGSHAGNKQAMQEFMILPTGACSFTEAMK.M 21.7 DMEB (67 kDa) Beta-adrenergic receptor kinase 1 ESQELLGSMAKK 40.1 DS3 (67 kDa) 2 ESQELLGSMAKK 40.1 C6/36 (67 kDa) 3 AKPGAEAHPPFRQHK 26.9 C6/36 (57 kDa) Translation elongation factor EF-1 alpha/Tu 1 SGDAAIVNLVPSWPLCVESFQEFPPLGR 82.9 Mori (extract) 2 NNPPKQAA 21.8 IBO 3 K.GASDFTAQVIVLNHPGQIANGYTPVLDCHTAVIACKFAEIQQK.V R.LPLQDVYK.I 63 C6/36 (80 kDa) Cadherin 1 FLIDYGSGTLELRIATK 52
Proteomic analysis was performed in protein from C6/36 cells, mosquito MGS purified by affinity chromatography (extract), or in the bands of interest excised after separation by SDS-PAGE.