Research Article
A Heparan Sulfate-Binding Cell Penetrating Peptide for Tumor Targeting and Migration Inhibition
Table 2
Multifunctional CPPs for tumor suppression.
| Name/sequence | Function | Mechanism | Cell line | Tumor mouse model | Ref. |
| CPPecp/NYRWRCKNQN | Cell penetrating HS binding Antimigration Antiangiogenesis Tumor targeting | Block putative HS coreceptor for growth factor | CT-26 HUVEC | Murine colon carcinoma CT-26 | [12–14] |
| Crotamine/YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG | Cell penetrating HS binding Antiproliferation Tumor targeting | Interact with lysosomes to trigger intracellular Ca2+ transients and alter mitochondrial membrane potential | B16F10 CHO-K1 | Murine melanoma (B16F10) Murine mammary carcinoma (TS/A-pc, TS/A-pc-pGL3) | [34, 57] |
| NFL-TBS. (40–63)/YSSYSAPVSSSLSVRRSYSSSSGS | Cell penetrating Antimigration Antiproliferation Apoptosis-inducing Antitumor growth | Inhibit polymerization of microtubules | Human glioblastoma (T98G) Rat glioblastoma (F98) Rat gliosarcoma (9L) | Murine glioblastoma (F98) | [72, 73] |
| TAT peptide (46–57)/SYGRKKRRQRRR | Cell penetrating HS binding Antiangiogenesis Apoptosis-inducing | Inhibit VEGF binding to HUVEC and inhibit phosphorylation of ERK | HUVEC | × | [25, 74] |
| p28/LSTAADMQGVVTDGMASGLDKDYLKPDD | Cell penetrating Antiangiogenesis Antitumor growth | Inhibit phosphorylation of VEGFR-2, FAK, and Akt | HUVEC | Human melanoma (UISO-Mel-6) | [75] |
|
|