Novel Numerical Characterization of Protein Sequences Based on Individual Amino Acid and Its Application

Table 1

The and values of 20 AAs and their coordinates in the 2D-Cartesian derived from (1).

Amino acid	Code	EH^0	Hp^0	EH^1	Hp^1
Alanine	A	0.62	1.8	0.62	2.29
Cysteine	C	0.29	2.5	0.29	2.99
Aspartate	D	−0.9	−3.5	−0.9	−3.01
Glutamate	E	−0.74	−3.5	−0.74	−3.01
Phenylalanine	F	1.19	2.8	1.19	3.29
Glycine	G	0.48	−0.4	0.48	0.09
Histidine	H	−0.4	−3.2	−0.4	−2.71
Isoleucine	I	1.38	4.5	1.38	4.99
Lysine	K	−1.5	−3.9	−1.5	−3.41
Leucine	L	1.06	3.8	1.06	4.29
Methionine	M	0.64	1.9	0.64	2.39
Asparagine	N	−0.78	−3.5	−0.78	−3.01
Proline	P	0.12	−1.6	0.12	−1.11
Glutamine	Q	−0.85	−3.5	−0.85	−3.01
Arginine	R	−2.53	−4.5	−2.53	−4.01
Serine	S	−0.18	−0.8	−0.18	−0.31
Threonine	T	−0.05	−0.7	−0.05	−0.21
Valine	V	1.08	4.2	1.08	4.69
Tryptophan	W	0.81	−0.9	0.81	−0.41
Tyrosine	Y	0.26	−1.3	0.26	−0.81

Protein I: WTFESRNKPAKDPVILWLNGGPGCSSLTGL.
Protein II: WFFESRNKPANDPIILWLNGGPGCSSFTGL.