Table 1: Epitopes predicted by bioinformatics on E protein with conservancy results.

ID of the predicted epitope#Epitope sequenceEpitope length (a.a.)Method of prediction (score)Percentage conservancy (min%)
⁢IntraserotypePan-serotype
DENV1DENV2DENV3DENV4

Entire E protein sequence9693979563
EP1/ESRDFVEGLSGATW
8–20/DI
13BepiPred (−1.6–0.26)841001009269
EP2/ESGATWV
16–21/DI
6Ellipro (0.5)831001008366
EP3/E CVTTMAKDKPTL
30–41/DI
12BepiPred (−0.06–0.95)75929210075
EP4/E TEVTNPAV
48–55/DI&DII
8BepiPred (−0.13–0.71)88881008813
EP5/EEAKISNTTTDSRCPTQGEATLVEEQDANFV CRRTFVDRGWGNGCGLFGKGSLITCAKFKCVT
62–123/DII
62Ellipro (0.8)9693966964
EP6/EAKISNTTTDSRCPTQGEATLVEEQDAN
63–89/DII
27BepiPred (−0.12–1.6)9693939367
EP7/EVDRGWGNGCGLF
97–108/DII
12BepiPred (−0.05–0.87)1008310010083
EP8/EHTGDQHQVGNESTEHGTTATITPQAPTTEIQLT
144–176/DI
33BepiPred (0.12–1.7)8885889042
EP9/EPQAPTTEIQLTDYGALTL
165–182/DI
17Ellipro (0.6)8894889435
EP10/EALTLDCSPRTGLD
180–192/DI
13BepiPred (−0.05–0.9)1008510010054
Ep11/ELPWTSGASTSQETWNR
218–233/DII
16BepiPred (0.06–1.8)9488888137
EP12/EGASTSQETW
223–231/DII
9Ellipro (0.6)8877777744
EP13/ELVTFKTAHAKKQEVVVLGS
237–255/DII
19Ellipro (0.7)94941008463
EP14/ETAHAKKQ
242–248/DII
7BepiPred (−0.04–0.78)868610010043
EP15/EVLGSQEGAMHTALTGATEIQTSGTTTI
252–278/DII & DI
27BepiPred (−0.03–1.66)9396968955
EP16/EFAGHLKCRLKMDKLTLKGMS
279–298/DI
20SVMTriP20 (0.9)90100859565
EP17/ELKMDKLTLKGMSYVMCTGSFKLEKEVA
287–313/DI&DIII
27Ellipro (0.6)9288929648
EP18/E FKLEKEVAETQHGT
306–319/DIII
14BepiPred (−0.14–0.95)100711009350
¥EP19/EKEVAETQHGTVLVQIKYEGT
310–329/DIII
20SVMTriP20 (1.0)9080958555
EP20/EVQIKYEGTDAPCKIPFSTQDEKGVTQNG
322–349/DIII
28Ellipro (0.7)9282968535
EP21/EYEGTDAPCKIPFSTQDEKGVTQNGRLIT
326–353/DII
28BepiPred (−0.16–1.5)9386968236
EP22/EPIVTDKEKPVNIEAEPPFGES
356–376/DIII
21BepiPred (−0.12–1.7)8686909043
EP23/EPIVTDKEKPV
356–365/DIII
10Ellipro (0.6)8080808010
EP24/EPPFGESYIVIGAGEKALKLSWFKKGSSIGKMF
371–402/DIII & Stem
32Ellipro (0.6)9381939359
EP25/EIGAGEKA
380–386/DIII
7BepiPred (−0.03–0.2)7186717129
EP26/EKKGSSIGKMFEATARGA
393–409/C-terminus
17BepiPred (−0.04–0.6)9488948871
EP27/EGDTAWDFGSIGGVFTSVGKL
416–435/C-terminus
20SVMTriP20 (0.9)9595959575
EP28/EDTAWDFGSIGGVFT
417–430/C-terminus
14BepiPred (−0.06–0.6)86921009271
EP29/EIGGVFTSVGKLVHQIFGTAYG
425–445/C-terminus
21Ellipro (0.6)8595919555
EP30/ETMKIGIGVLLTWLGLNSRSTSLSMTCIAVGLITLY
454–488/C-terminus
35Ellipro (0.8)9191948842
EP31/EIGVLLTWLGLNSRSTSLSM
459–478/C-terminus
19SVMTriP20 (0.8)8994949452
EP32/ENSRSTSL
469–475/C-terminus
7BepiPred (−0.14–0.2)861008610057

Sequence position/domain. Epitope sequence is given with reference to DENV1 isolate AY713476. Epitopes that have been previously described by other authors (cited in the Discussion).