Table 3: Overlapping epitopes on the E protein.

BepiPredElliproSVMTriP

8SRDFVEGLSGATW20
EP1/E
16SGATWV21
EP2/E
NP

63AKISNTTTDSRCPTQGEATLVEEQDAN89
EP6/E
62EAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVDRGWGNGCGLFGKGSLITCAKFKCVT123
EP5/E
NP
97VDRGWGNGCGLF108
EP7/E

144HTGDQHQVGNESTEHGTTATITPQAPTTEIQLT176
EP8/E
165PQAPTTEIQLTDYGALTL182
EP9/E
NP
180ALTLDCSPRTGLD192
EP10/E

218LPWTSGASTSQETWNR233
EP11/E
223GASTSQETW231
EP12/E
NP

242TAHAKKQ248
EP14/E
237LVTFKTAHAKKQEVVVLGS255
EP13/E
NP
252VLGSQEGAMHTALTGATEIQTSGTTTI278
EP15/E

306FKLEKEVAETQHGT319
EP18/E
287LKMDKLTLKGMSYVMCTGSFKLEKEVA313
EP17/E
279FAGHLKCRLKMDKLTLKGMS298
EP16/E
326YEGTDAPCKIPFSTQDEKGVTQNGRLIT353
EP21/E
322VQIKYEGTDAPCKIPFSTQDEKGVTQNG349
EP20/E
310KEVAETQHGTVLVQIKYEGT329
EP19/E 

356PIVTDKEKPVNIEAEPPFGES376
EP22/E
356PIVTDKEKPV365
EP23/E
NP
380IGVGEKA386
EP25/E
371PPFGESYIVIGVGEKALKLSWFKKGSSIGKMF402
EP24/E
393KKGSSIGKMFEATARGA409
EP26/E

417DTAWDFGSIGGVFT430
EP28/E
425IGGVFTSVGKLVHQIFGTAYG445
EP29/E
416GDTAWDFGSIGGVFTSVGKL435
EP27/E

469NSRSTSL475
EP32/E
454TMKIGIGVLLTWLGLNSRSTSLSMSCIAVGIITLY488
EP30/E
459IGVLLTWLGLNSRSTSLSM478
EP31/E

NP: no prediction in the relevant region; bold italics indicates sequences that overlap between the predicted epitopes by three different tools.