Table 4: Overlapping epitopes of the prM protein.

BepiPredElliproSVMTriP

4TTRGGEPHMIVSKQERG20
EP2/prM
1FHLTTRGGE9
EP1/prM
NP
15SKQERGKS22
EP3/prM

44LCEDTMTYKCPRITEAEPDDVDCWCNATDTWVTYGTCSQTGEHRRDKRSV93
EP6/prM
55RITEAEPDDVD65
EP7/prM
NP

125TWALR129
EP10/prM
145GTSITQ150
EP13/prM
115GAWKQIQRVETWALRHPGFTVILALFLAHAIGTSITQKGIIFILLMLVTPS165
EP12/prM
127ALRHPGFTILALFLAHAIGT146
EP11/prM

NP: no prediction in the relevant region; bold italics indicates sequences that overlap between the predicted epitopes by three different tools.