Table 1: The table shows the filtering of antimicrobial peptides from various sources based on length, WWIHS, iHMM, and net charge.

S.No Peptide APD3 ID Definition LengthWWIHS iHHM Net charge

1 KTCENLADTFRGPCFATSNCAP00532Lunatusin201.82.62 0
2 GLFVGVLAKVAAHVVPAIAEHFAP00260 Maculatin 1.1 22 1.29 3.26 1
3 GIGKFLHSAGKFGKAFVGEIMKSAP00771 Magainin 1 23 1.34 7.19 3
4 GIGKFLHSAKKFGKAFVGEIMNSAP00144Magainin 2 23 0.93 7.1 3
5 GEGFLGMLLHGVGHAIHGLIHGKAP02663Piscidins 23 1.26 4.72 0
6 GLRSKIWLWVLLMIWQESNKFKKMAP00764 Dermaseptin-S9 24 6.07 2.95 4
7 FLPVLAGIAAKVVPALFCKITKKCAP00074Brevinin-1 24 1.31 3.48 4
8 GWGSFFKKAAHVGKHVGKAALTHYLAP00166Pleurocidin 25 0.37 7.49 4
9 FFGWLIRGAIHAGKAIHGLIHRRRHAP00340Chrysophsin-2 25 0.02 5.97 0
10 ALWMTLLKKVLKAAAKAALNAVLVGANAAP00160Dermaseptin-S4 28 0.92 4.71 4
11 GLPVCGETCVGGTCNTPGCTCSWPVCTRNAP00729Kalata B1 29 1.94 3.64 0
12 GAFGNFLKGVAKKAGLKILSIAQCKLSGTCAP01644Brevinin-2-RN1 30 0.62 1.97 5
13 GWFKKAWRKVKNAGRRVLKGVGIHYGVGLIAP00692Hagfish cathelicidin 30 0.24 6.41 8
14 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKDAP00730Kalata B8 31 2.47 2.06 1
15 RRCICTTRTCRFPYRRLGTCIFQNRVYTFCCAP00174Guinea pig neutrophil 31 2.16 2.06 7
16 ACYCRIGACVSGERLTGACGLNGRIYRLCCRAP00225RatNP-4 rat defensin, 31 2.43 2.58 4
17 GVIPCGESCVFIPCISTLLGCSCKNKVCYRNAP00275Circulin B 31 2.44 3.23 2
18 GVIPCGESCVFIPCISAAIGCSCKNKVCYRNAP01022Cycloviolin A 31 1.43 2.52 2
19 KIPCGESCVWIPCVTSIFNCKCKENKVCYHDAP01061Circulin D 31 1.27 5.43 1
20 GSIPACGESCFKGKCYTPGCSCSKYPLCAKNAP01065Cycloviolacin O14 31 0.73 1.48 3
21 CGESCVFIPCITTVLGCSCSIKVCYKNGSIPAP02571Cycloviolacin VY1 31 3.15 2.77 1
22 ATCYCRTGRCATRESLSGVCEISGRLYRLCCRAP00180Human defensin 5 32 1.39 3.83 4
23 AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCLAP00181Human defensin 6 32 3.82 2.56 2
24 VTCYCRRTRCGFRERLSGACGYRGRIYRLCCRAP00222RatNP-1 rat defensin 32 1.02 4.29 8
25 VTCYCRSTRCGFRERLSGACGYRGRIYRLCCRAP00223RatNP-2 rat defensin 32 1.7 4.01 7
26 GFFALIPKIISSPLFKTLLSAVGSALSSSGEQEAP00641Pardaxin 1 33 4.19 0.2 0
27 VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVAP00179Human neutrophil peptide-4333.28 1.54 4
28 DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSWAP00036Bovine beta-defensin 138 0.22 4.72 4
29 GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYAP00549Plectasin 40 2.11 3.67 1
30 GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYSAP00744Chicken AvBD5 41 0.93 3.26 3
31 SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWAAP00742Chicken AvBD642 0.58 2.64 7
32 KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKSAP00846Mundticin KS43 0.83 2.1 4
33 QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSRAP01788Myticin C43 4.62 0.95 2
34 VSFPWSCAALSGVCRQGACLPSELYFGPLGCGKGSLCCVSYFLAP02830Channel catfish beta defensin438.812.3 1
35 KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNCAP01356Cp-thionin II46 0.39 2.59 7
36 FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWGAP02148Apl-AvBD16503.26 5.26 5
37 LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPPAP02733Piscidin 6552.93 6.41 5