The S-Layer Glycoprotein of the Crenarchaeote Sulfolobus acidocaldarius Is Glycosylated at Multiple Sites with Chitobiose-Linked N-Glycans
Figure 4
Summed mass spectra recorded between 46 and 52 min from an on-line nanoLC-ES-MS/MS analysis of an in-gel tryptic digest of the S-layer. The quadruply charged signals at m/z 1014.07, 1111.59 and 1151.09 are molecular ions of glycopeptides of sequence GAGVVEFLLTAYPYTGNITFAPPWFIAENVVK carrying the glycans shown in the annotations. Unassigned signals are molecular ions of peptides from elsewhere in the S-layer.