BioMed Research International / 2010 / Article / Tab 3

Research Article

Correctness of Protein Identifications of Bacillus subtilis Proteome with the Indication on Potential False Positive Peptides Supported by Predictions of Their Retention Times

Table 3

Test peptides from proteins of Bacillus subtilis proteome, identified on the basis of more than one peptide with 𝐗 c o r r above 1.5.

Peptide sequencem/zMissed cleavagesCharge 𝑋 c o r r l o g S u m ( π‘˜ + 1 ) A A c l o g P 𝑑 𝑅 e x p 𝑑 𝑅 p r e d Dt R

ALDMLEASPVQGFDAK846.96024.901.52 βˆ’ 4 . 7 1 32.5627.664.90
ITGTSNYEDTAGSDIVVITAGIAR1213.32024.871.63 βˆ’ 6 . 3 8 34.6130.194.42
RHDDYDSKK582.61122.571.10 βˆ’ 7 . 9 0 12.2611.840.42
KPHHHCDDYK640.70123.171.13 βˆ’ 6 . 1 2 14.3414.260.08
DYLYQEPHGK625.67022.601.33 βˆ’ 4 . 7 2 24.8621.523.34
EGLKDYLYQEPHGK839.42122.811.46 βˆ’ 5 . 9 9 30.8925.035.86
KEGLKDYLYQEPHGK903.51223.711.48 βˆ’ 4 . 7 9 32.1826.415.77
YYKKPHHHCDDYK867.96221.941.38 βˆ’ 4 . 2 9 33.9323.4610.47
GTAMAYDQIDGAPEER862.92023.631.38 βˆ’ 8 . 0 6 23.4320.862.57
TVGSGVVSTITE1150.26011.421.27 βˆ’ 5 . 0 7 24.5419.445.10
GITISTAHVEYETETR904.47024.861.44 βˆ’ 7 . 3 9 24.4323.061.37
GQVLAKPGTITPHSK767.89122.771.37 βˆ’ 6 . 8 2 27.5721.336.24
VGDEVEIIGLQEENKK900.99124.591.46 βˆ’ 6 . 0 8 29.4924.804.69
HYAHVDCPGHADYVK856.94024.621.39 βˆ’ 4 . 9 5 30.9123.307.61
DLLSEYDFPGDDVPVVK955.04024.921.58 βˆ’ 4 . 4 6 35.0330.005.03
LLDYAEAGDNIGALLR852.95023.631.59 βˆ’ 4 . 4 9 36.1730.205.97
NMITGAAQMDGAILVVSAADGPMPQTR1359.07025.041.64 βˆ’ 7 . 2 0 37.0229.787.24
SHANIGTIGHVDHGKTTLTAAITTVLHKKSGK1099.25333.271.72 βˆ’ 1 1 . 8 3 39.5728.7110.86
NVGVPYIVVFLNKCDMVDDEELLELVEMEVR1806.60124.261.85 βˆ’ 4 . 9 7 53.4238.1515.27
ALAPEIVGEEHYAVAR863.46022.541.46 βˆ’ 4 . 8 7 30.3625.854.51
EGNDLFYEMSDSGVINK960.03024.611.56 βˆ’ 6 . 5 7 31.7727.823.95
GMEAVDTGAPISVPVGDVTLGR1071.71025.501.54 βˆ’ 5 . 6 8 32.5627.814.75
VFNVLGENIDLNEPVPADAK1078.20025.911.61 βˆ’ 5 . 1 5 34.4130.443.97
KLTEMGIYPAVDPLASTSR1025.68123.851.56 βˆ’ 4 . 8 0 34.6329.005.63
VQPGQQHLKR596.18122.371.18 βˆ’ 6 . 7 7 15.3615.230.13
IVSINPADKEEVVGR813.92023.321.40 βˆ’ 5 . 9 3 27.2122.884.33
AGGPDYLALHMQAK736.85023.681.43 βˆ’ 4 . 6 3 29.6524.934.72
VSDFDEALEVANNTEYGLTGAVITNNRK1014.75134.371.72 βˆ’ 9 . 4 3 36.8530.666.19
GYFIKPTIFADLDPK863.50123.551.62 βˆ’ 1 . 1 2 38.3633.884.48
LMQEEIFGPVVAFCK856.54023.251.59 βˆ’ 0 . 0 8 40.3433.486.86
QQNQSAEQNKQQNS816.82122.811.15 βˆ’ 1 3 . 8 3 9.138.820.31
KQNQQSAAGQGQFGTEFASETNAQQVR1456.52125.751.61 βˆ’ 1 1 . 7 8 25.8425.380.46
YDDYDKK946.98111.901.15 βˆ’ 2 . 9 7 13.7917.243.45
DYDCDYDKK583.11122.761.21 βˆ’ 5 . 8 1 16.5216.930.41
DYDYVVEYK597.64023.301.34 βˆ’ 3 . 3 1 25.7823.082.70
DYDYVVEYKK661.72122.571.36 βˆ’ 3 . 3 2 26.0723.702.37
VGNDGVITIEESK681.24022.661.34 βˆ’ 6 . 2 0 23.9220.833.09
FGSPLITNDGVTIAK767.38022.731.52 βˆ’ 4 . 1 6 30.3328.232.10
EIELEDAFENMGAK798.87023.311.46 βˆ’ 5 . 9 6 32.8625.017.85
ESIAQVAAISAADEEVGSLIAEAMER1331.46026.411.64 βˆ’ 8 . 7 9 46.5528.4818.07
WNTNAGDDYVSNGPFK893.43022.631.57 βˆ’ 5 . 8 3 27.5528.400.85
GVIMPGTGEVYFR713.83022.421.47 βˆ’ 1 . 2 6 32.2328.953.28
ADYTGPDKQK562.10122.851.13 βˆ’ 5 . 8 9 14.1314.440.31
MLTEIGEVENAEPYIR933.05024.381.51 βˆ’ 4 . 6 1 31.827.654.15
EDYGIAENFLYTLNGEEPSPIEVEAFNK1595.71023.181.80 βˆ’ 7 . 2 2 40.2535.035.22
MSGWLAHILEQYDNNRLIRPR861.99233.541.73 βˆ’ 7 . 6 2 43.0532.4510.60
VLQQPNCLEVTISPNGNK978.11024.431.50 βˆ’ 5 . 9 3 28.7526.152.60
YRDNNYLDDEHEVIAK998.05124.611.50 βˆ’ 6 . 8 5 29.3525.493.86
IVVQAEREFLAEVVGETK1009.65122.991.56 βˆ’ 4 . 4 8 38.229.179.03
IVNPLGQPVDGLGPILTSK960.13025.181.60 βˆ’ 3 . 3 6 35.8631.394.47
KGRNPQTGEEIEIPASKVPAFKPGK894.02434.531.59 βˆ’ 7 . 2 1 33.2228.244.98
MNKTELINAVAEASELSK975.11125.111.50 βˆ’ 6 . 3 8 35.3225.919.41
MNKTELINAVAEASELSKK1039.19225.251.51 βˆ’ 6 . 5 8 35.6426.199.45
AVDSVFDTILDALKNGDKIQLIGFGNFEVR1099.57235.811.87 βˆ’ 5 . 3 0 50.0138.6811.33

We are committed to sharing findings related to COVID-19 as quickly and safely as possible. Any author submitting a COVID-19 paper should notify us at help@hindawi.com to ensure their research is fast-tracked and made available on a preprint server as soon as possible. We will be providing unlimited waivers of publication charges for accepted articles related to COVID-19. Sign up here as a reviewer to help fast-track new submissions.