BioMed Research International / 2014 / Article / Tab 1

Research Article

A Proteomic View to Characterize the Effect of Chitosan Nanoparticle to Hepatic Cells: Is Chitosan Nanoparticle an Enhancer of PI3K/AKT1/mTOR Pathway?

Table 1

The eight unique proteins identified by the higher confidence level (at least three unique peptide sequences matched) with significant difference between CCL-13 and HepG2 cells incubation with chitosan nanoparticles in this study.

CellSwiss-Prot NumberProtein NameSubcellular locationMW (Da)ScoreQueriespIMolecular functionSequence coveragePeptide

CCL-13Q16478Glutamate receptor, ionotropic kainate 5
(GRIK5)
Cell membrane1091958298.54extracellular-glutamate-gated ion channel activity
kainate selective glutamate receptor activity
28%K.VSTIIIDANASISHLILRK.A + Deamidated (NQ); 2 Phospho (ST)
R.LQYLRFASVSLYPSNEDVSLAVSRILK.S + 2 Deamidated (NQ)
K.VGPEETPRLQYLR.F
R.LNCNLTQIGGLLDTK.G + 2 Deamidated (NQ); Phospho (ST)
R.LNCNLTQIGGLLDTK.G + 3 Deamidated (NQ); Phospho (ST)
R.RLNCNLTQIGGLLDTK.G + 2 Deamidated (NQ); Phospho (ST)
K.VSTIIIDANASISHLILRK.A + Deamidated (NQ); 2 Phospho (ST)
M.PAELLLLLIVAFASPSCQVLSSLR.M + Deamidated (NQ)
-.MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGR.G + Carbamidomethyl (C); Deamidated (NQ); Oxidation (M); 2 Phospho (ST)
O43182Rho GTPase-activating protein 6
(ARHGAP6)
Cytoplasm10588272137.11Rho GTPase activator activity
SH3/SH2 adaptor activity
phospholipase activator activity
29%R.EQQVTQK.K
K.DPGMTGSSGDIFESSSLR.A + 4 Phospho (ST)
-.MSAQSLLHSVFSCSSPASSSAASAK.G + Deamidated (NQ); Oxidation (M); 3 Phospho (ST)
R.EQQVTQKKLSSANSLPAGEQDSPR.L + 2 Phospho (ST)
K.DASDFVASLLPFGNK.R + Deamidated (NQ); Phospho (ST)
R.LRSVPIQSLSELERAR.L + Deamidated (NQ)
R.LRSVPIQSLSELERAR.L + Phospho (ST)
K.MTSLNLATIFGPNLLHKQK.S + Deamidated (NQ); Oxidation (M)
K.DPGMTGSSGDIFESSSLR.A + 4 Phospho (ST)
R.TQAAAPATEGR.A + Deamidated (NQ); Phospho (ST)
R.TQAAAPATEGR.A + Deamidated (NQ); Phospho (ST)
K.DPGMTGSSGDIFESSSLR.A + 4 Phospho (ST)
R.HSSTDSNKASSGDISPYDNNSPVLSER.S + Deamidated (NQ); 6 Phospho (ST)

HepG2P05067Amyloid beta A4 protein
(APP)
Membrane868884944.73DNA binding
heparin binding
peptidase activator activity
serine-type endopeptidase inhibitor activity
transition metal ion binding
19%R.LNMHMNVQNGK.W + Deamidated (NQ); 2 Oxidation (M)
K.WDSDPSGTKTCIDTK.E + 5 Phospho (ST)
K.GAIIGLMVGGVVIATVIVITLVMLKK.K + Oxidation (M); Phospho (ST)
R.ALEVPTDGNAGLLAEPQIAMFCGR.L + 2 Deamidated (NQ); Oxidation (M); Phospho (ST)
P51685C-C chemokine receptor type 8
(CCR8)
Cell membrane408174748.66C-C chemokine receptor activity
chemokine receptor activity
coreceptor activity
12%R.ESCEKSSSCQQHSSR.S + Carbamidomethyl (C); Deamidated (NQ); 3 Phospho (ST)
R.ESCEKSSSCQQHSSR.S + Carbamidomethyl (C); 2 Deamidated (NQ); 5 Phospho (ST)
R.ESCEKSSSCQQHSSR.S + Carbamidomethyl (C); 2 Deamidated (NQ); 5 Phospho (ST)
R.ESCEKSSSCQQHSSR.S + Carbamidomethyl (C); 2 Deamidated (NQ); 5 Phospho (ST)
P16070CD44 antigen
(CD44)
Membrane814876035.13collagen binding
hyaluronic acid binding
hyalurononglucosaminidase activity
4%R.YGFIEGHVVIPR.I
K.ALSIGFETCRYG FIEGHVVIPR.I
K.EQWFGNRWHEGYR.Q
O95067G2/mitotic-specific cyclin-B2
(CCNB2)
452535839.2116%R.KKLQLVGITALLLASK.Y
K.VPVQPTKTTNVNKQLKPTASVKPVQMEK.L + Deamidated (NQ); Oxidation (M); Phospho (ST)
K.AQNTKVPVQPTKTTNVNK.Q + 3 Deamidated (NQ); 2 Phospho (ST)
Q09666Neuroblast differentiation-associated protein
(AHNAK)
Nucleus6286993975.812%K.GPKFKIPEMHLK.A
K.FKMPSMNIQTHK.I + Deamidated (NQ); Oxidation (M); Phospho (ST)
K.MDAEVPDVNIEGPDAKLK.G + Deamidated (NQ)
K.KSRLSSSSSNDSGNK.V + 2 Deamidated (NQ); 6 Phospho (ST)
K.MKLPQFGISTPGSDLHVNAK.G
K.VHAPGLNLSGVGGKMQVGGDGVK.V + Deamidated (NQ); Oxidation (M); Phospho (ST)
R.AGAISASGPELQGAGHSKLQVTMPGIKVGGSGVNVNAK.G + 2 Deamidated (NQ); Oxidation (M); 4 Phospho (ST)
P09486Osteonectin/
SPARC protein
(SPARC)
Secreted346108934.73calcium ion binding
collagen binding
extracellular matrix binding
4%R.LEAGDHPVELLAR.D
K.HGKVCELDENNTPMCVCQDPTSCPAPIGEFEK.V + 3 Carbamidomethyl (C)
R.APLIPMEHCTTR.F