Review Article
Cucurbitaceae Seed Protein Hydrolysates as a Potential Source of Bioactive Peptides with Functional Properties
Table 2
Polypeptides and oligopeptides with different bioactive properties in vitro identified in Cucurbitaceae seed proteins.
| Source | Sequence | Molecular weight (kDa) | Properties | Reference |
| Pumpkin (Cucurbita maxima) | KRDPDWRREQEERREQERRREQQQQRREEQQRGER | 12.33 | Antifungal | Vassiliou et al. [35] | YTRGGRGGWKGGGGGKGGGGGKGGGGG | 2.34 |
| Pumpkin (Cucurbita moschata cv. black pumpkin) | PQRGEGGRAGNLLREEQEI | ~9 | Antifungal | Wang and Ng [36] |
| Momordica cochinchinensis | GCEGKQCGLFRSCGGGCRCWPTVTPGVGICSSS | 3.29 | Anticarcinogenic | Chan et al. [37] | GCEGKPCGLFRSCGGGCRCWPTVTPGVGICSS | 3.17 |
| Benincasa hispida | SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR | 5.75 | Antimicrobial and antioxidant | Sharma et al. [38] |
| Bitter melon (Momordica charantia) | FREKVYNIPL | 1.28 | ACE-inhibitory activity | Priyanto et al. [33] | VSGAGRY | 0.71 | ITLPYSGNYER | 1.31 | IAAGKPREKIP | 1.18 | IAAGKPREKIPIGLPA | 1.63 | LLHYDSTAAAGALLVLIQTTAEAAR | 2.57 | LHYDSTAAAGALLVLIQTTAEAAR | 2.46 | LAQGNNGIFRTPIVL | 1.61 | IFRTPIVL | 0.96 | VDNKGNR | 0.80 | FFKESPPEA | 1.05 | FFKESPPEAYN | 1.33 | IISLENQWSA | 1.16 | FRNPVDL | 0.86 | QASESLN | 0.75 | LRYDDGWM | 1.05 | IVLSSATDKGNGQQWT | 1.70 |
|
|