Enzyme Research

Enzyme Research / 2012 / Article / Tab 4

Research Article

In Silico Characterization of Histidine Acid Phytase Sequences

Table 4

Distribution of commonly observed motifs in different HAPhy protein sequences along with their functional domains.

Motifs numberMotif present in number of sequenceMotif widthSequenceDomain

13841SPFCDLFTHEEWIQYDYLQSLGKYYGYGAGNPLGPAQGIGFHP_HAP_like, histidine phosphatases superfamily
24929VPPGCKITFVQVLSRHGARYPTKSKSKMYHistidine phosphatase superfamily
34730VRVLVNDRVVPLHGCLVDPLGRCKLDDFVALocal conserved domain
44929TLYADFSHDNDMTSIFTALGLYNGTEPLSHistidine phosphatase superfamily
52650YAFLKTYNYSLGADDLTPFGEQQLVDSGIKFYQRYESLAKDIVPFIRASGHistidine phosphatase superfamily
64929RLNKALPGVNLTSADVVSLMDMCSFETVAHistidine phosphatase superfamily
74821GYSAAWTVPFGARAYFEKMQCHistidine phosphatase superfamily
81150TEIFLLQQAQGMPEPGWGRITDSHQWNTLLSLHNAQFYLLQRTPEVARSRLocal conserved domain
91250KKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDPHistidine phosphatase superfamily
10950TPHPPQKQAYGVTLPTSVLFIAGHDTNLANLGGALELNWTLPGQPDNTPPHistidine phosphatase superfamily

Article of the Year Award: Outstanding research contributions of 2020, as selected by our Chief Editors. Read the winning articles.