Table 3: Conservativeness of epitopic PV peptide regions among 43 PV strains and variants.

PV strainUniProt/Swiss-Prot entry aa Pos 464aa Pos 708aa Pos 748aa Pos 763aa Pos
783
aa Pos 835aa Pos 847

PV1 MahoneyP03300FMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1 SabinP03301SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV3 P3/Leon/37P03302SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3 23127P06209SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRvYVWCPR
PV1 isolatedQ9Q281SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKvRVYVWCPR
PV1 isolatedQ9Q280SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1 isolatedQ71AZ9SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1 isolatedQ5TLH5SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01008C2D1YSI9SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01009D1YSJ1SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01008D1YSJ2SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01002D1YSJ3SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01001D1YSJ4SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR01012D1YSJ5SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR01002CD1YSJ6SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR01002D1YSJ7SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR01001C1D1YSJ9SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00042C2D1YSK1SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00042C1D1YSK2SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00042D1YSK3SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00041C3D1YSK4SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00041C2D1YSK5SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00044D1YSK6SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00028CD1YSK7SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00028D1YSK8SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00023CD1YSK9SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00025D1YSL0SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOOR24D1YSL1SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00015D1YSL2SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-DOR00016D1YSL3SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01013allD1YSL4SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-HAI01015D1YSL5SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV1-S302D2X673SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
CHN8184/GZ/CHN/2004D8L541SMMATGRFDMEKWDDYTWQTFYTYGAYSHFYDKIRVYVWCPR
PV3 isolatedB4YUL3SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRVYVWCPR
PV3 isolatedB4YUL4SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRVYVWCPR
PV3 (vacc.StrainSabin3
(Leon 12a1b))
Q84792SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-33239C5HJY2SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-31974C5HJY3SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-FIN84-60212D1GE40SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-SWI10947D2E679SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-FIN84-2493D1GE41SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR
PV3-P3/Jinan/1/09D2XUS9SMMATGRFDMEsWDDYTWQTFYTYGAYSHFYDKvRiYVWCPR

The 43 PV sequences were aligned using ClustalW multialignment program (http://www.uniprot.org/align/) [24]. The analyzed PV sequences and related references are described at http://www.uniprot.org/ and reported by Swiss-Prot/UniProtKB accession number. Peptide sequences present in PV-derived epitopes (see Table 2) and absent in the human proteome were localized along the 43 aligned PV sequences and analyzed for conservativeness. Peptide sequences are indicated by their position along the PV polyprotein. Mutated aa residues are in lower case.