Leukemia Research and Treatment / 2012 / Article / Tab 1

Research Article

Identification of a Novel P190-Derived Breakpoint Peptide Suitable for Peptide Vaccine Therapeutic Approach in Ph+ Acute Lymphoblastic Leukemia Patients

Table 1

p190 amino acid sequence (e1a2 breakpoint) and all 25 possible 25-mer peptides that include fusion point.

        BCR           ABL
 TIVGVRKTGQIWPNDGEGAFHGDAEALQRPVASDFEPQGLSEAARWNSK
(1) TIVGVRKTGQIWPNDGEGAFHGDAE
(2)IVGVRKTGQIWPNDGEGAFHGDAEA
(3)  VGVRKTGQIWPNDGEGAFHGDAEAL
(4)     GVRKTGQIWPNDGEGAFHGDAEALQ
(5)    VRKTGQIWPNDGEGAFHGDAEALQR
(6)    RKTGQIWPNDGEGAFHGDAEALQRP
(7)      KTGQIWPNDGEGAFHGDAEALQRPV
(8)     TGQIWPNDGEGAFHGDAEALQRPVA
(9)      GQIWPNDGEGAFHGDAEALQRPVAS
(10)       QIWPNDGEGAFHGDAEALQRPVASD
(11)       IWPNDGEGAFHGDAEALQRPVASDF
(12)         WPNDGEGAFHGDAEALQRPVASDFE
(13)          PNDGEGAFHGDAEALQRPVASDFEP
(14)          NDGEGAFHGDAEALQRPVASDFEPQ
(15)          DGEGAFHGDAEALQRPVASDFEPQG
(16)             GEGAFHGDAEALQRPVASDFEPQGL
(17)            EGAFHGDAEALQRPVASDFEPQGLS
(18)           GAFHGDAEALQRPVASDFEPQGLSE
(19)              AFHGDAEALQRPVASDFEPQGLSEA
(20)             FHGDAEALQRPVASDFEPQGLSEAA
(21)             HGDAEALQRPVASDFEPQGLSEAAR
(22)                GDAEALQRPVASDFEPQGLSEAARW
(23)               DAEALQRPVASDFEPQGLSEAARWN
(24)               AEALQRPVASDFEPQGLSEAARWNS
(25)                 EALQRPVASDFEPQGLSEAARWNSK

We are committed to sharing findings related to COVID-19 as quickly and safely as possible. Any author submitting a COVID-19 paper should notify us at help@hindawi.com to ensure their research is fast-tracked and made available on a preprint server as soon as possible. We will be providing unlimited waivers of publication charges for accepted articles related to COVID-19. Sign up here as a reviewer to help fast-track new submissions.