Leukemia Research and Treatment / 2012 / Article / Tab 1

Research Article

Identification of a Novel P190-Derived Breakpoint Peptide Suitable for Peptide Vaccine Therapeutic Approach in Ph+ Acute Lymphoblastic Leukemia Patients

Table 1

p190 amino acid sequence (e1a2 breakpoint) and all 25 possible 25-mer peptides that include fusion point.

        BCR           ABL
 TIVGVRKTGQIWPNDGEGAFHGDAEALQRPVASDFEPQGLSEAARWNSK
(1) TIVGVRKTGQIWPNDGEGAFHGDAE
(2)IVGVRKTGQIWPNDGEGAFHGDAEA
(3)  VGVRKTGQIWPNDGEGAFHGDAEAL
(4)     GVRKTGQIWPNDGEGAFHGDAEALQ
(5)    VRKTGQIWPNDGEGAFHGDAEALQR
(6)    RKTGQIWPNDGEGAFHGDAEALQRP
(7)      KTGQIWPNDGEGAFHGDAEALQRPV
(8)     TGQIWPNDGEGAFHGDAEALQRPVA
(9)      GQIWPNDGEGAFHGDAEALQRPVAS
(10)       QIWPNDGEGAFHGDAEALQRPVASD
(11)       IWPNDGEGAFHGDAEALQRPVASDF
(12)         WPNDGEGAFHGDAEALQRPVASDFE
(13)          PNDGEGAFHGDAEALQRPVASDFEP
(14)          NDGEGAFHGDAEALQRPVASDFEPQ
(15)          DGEGAFHGDAEALQRPVASDFEPQG
(16)             GEGAFHGDAEALQRPVASDFEPQGL
(17)            EGAFHGDAEALQRPVASDFEPQGLS
(18)           GAFHGDAEALQRPVASDFEPQGLSE
(19)              AFHGDAEALQRPVASDFEPQGLSEA
(20)             FHGDAEALQRPVASDFEPQGLSEAA
(21)             HGDAEALQRPVASDFEPQGLSEAAR
(22)                GDAEALQRPVASDFEPQGLSEAARW
(23)               DAEALQRPVASDFEPQGLSEAARWN
(24)               AEALQRPVASDFEPQGLSEAARWNS
(25)                 EALQRPVASDFEPQGLSEAARWNSK

Article of the Year Award: Outstanding research contributions of 2020, as selected by our Chief Editors. Read the winning articles.