Table 2: Conserved motif 2 of tick p36 proteins mapped as a potential antigenic/binding site region.

Tick speciesNCBI accession numberAntigenic scoreConserved Motif 2 locationAntigenic region antigenic peptide tool/SVM Trip toolMapped immunogenic segments of Motif 2
Epitopia tool
Mapped Binding sites of Motif 2
Sprint pep tool
Predicted ligands for Motif 2
Coach tool

D. andersoniAAF03683.10.5880107–12795–128IDKGMLSPFNLSATVKFPLIPIDKGMLSPFNLSATVKFPLIPLactose, Glycerol, NAG-(4-1)GAL, Sucrose

R. appendiculatusJAP81944.10.7701117–137108–137IDNGIKTPFHLKAVFSFPITGIDNGIKTPFHLKAVFSFPITG-

R. appendiculatusJAP88013.10.7379113–133104–133IDNGIKTPFHLKAVFSFPITGIDNGIKTPFHLKAVFSFPITG-

R. appendiculatusJAP81510.10.7258102–12294–133IDDSMYSPFNIMTTVAFPLIGIDDSMYSPFNIMTTVAFPLIGB-Octylglucoside

R. appendiculatusJAP86350.10.707278–9874–110IDYGIYSPFNLVTPVQFPLMGIDYGIYSPFNLVTPVQFPLMGAlpha-D-Mannose, Alpha-D-Lactose, B-Octylglucoside

Bold sections: tick p36 conserved region residues mapped as potentially antigenic/binding sites.