Research Article
“In Silico” Characterization of 3-Phytase A and 3-Phytase B from Aspergillus niger
Table 5
Antigenic determinants of 3-phytase A and of chain A in 3-phytase B from A. niger.
| Fragment number | Position | Sequence | Position | Total Number | Initial | Final | a.a. |
| Antigenic determinants of 3-phytase A (Long. Total = 444 a.a.) | Mean antigenic propensity = 1.0304 | 1 | 23 | HLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSR | 58 | 36 | 2 | 374 | SAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGR | 420 | 47 |
| Antigenic determinants of chain A in 3-phytase B (Long. Total = 460 a.a.) | Mean antigenic propensity = 1.0234 | 1 | 322 | ITPILAALGVLIPNE | 336 | 15 | 2 | 378 | TYVRLVLNEAVLPFN | 392 | 15 |
|
|