Research Article
Antifungal Activities of Peptides Derived from Domain 5 of High-Molecular-Weight Kininogen
Table 1
D5-derived and control peptides investigated.
| Peptide | Sequence | Mw | pI1 | Net charge | Mean hydrophobicity2 |
| KHN20 | KHNLGHGHKHERDQGHGHQR | 2365.5 | 9.99 | +2 | −4.91 | GHG20 | GHGLGHGHEQQHGLGHGHKF | 2127.2 | 7.21 | 0 | −2.01 | GHG21 | GHGHKFKLDDDLEHQGGHVLD | 2354.5 | 5.63 | −3 | −2.32 | GGH20 | GGHVLDHGHKHKHGHGHGKH | 2169.3 | 9.70 | +2 | −3.44 | HKH20 | HKHGHGHGKHKNKGKKNGKH | 2151.5 | 10.78 | +7 | −5.91 | GKH17 | GKHKNKGKKNGKHNGWK | 1946 | 10.78 | +7 | −5.77 | GKH17WWW | GKHKNKGKKNGKHNGWKWWW | 2505 | 10.78 | +7 | −3.45 | GKH17WWWWW | GKHKNKGKKNGKHNGWKWWWWW | 2287 | 10.78 | +7 | −2.25 | LL-37 | [LL-37, 37 aa] | 4492 | 10.61 | +6 | −1.84 | Histatin-5 | DSHAKRHHGYKRKFHEKHHSHRGY | 3036 | 10.28 | +5 | −4.67 |
|
|
Mw: molecular weight. 1pI: theoretical isoelectric point calculated by using the Protparam tool available at http://us.expasy.org/tools/protparam.html. 2Mean hydrophobicity calculated using HydroMCalc (combined consensus hydrophobicity scale) available at http://www.bbcm.univ.trieste.it/~tossi/HydroCalc/HydroMCalc.html.
|