Journal of Allergy / 2010 / Article / Tab 8

Research Article

Towards Defining Molecular Determinants Recognized by Adaptive Immunity in Allergic Disease: An Inventory of the Available Data

Table 8

Epitopes associated with modulation of allergic disease.

Epitope nameEpitope sequenceHostResponseAllergy model

Cyn d 1 (127–146)KAGELTLQFRRVKCKYPSGTHumanT cell, DCPBermuda grass pollen
Cyn d 1 (19–38)LEAKATFYGSNPRGAAPDDHHumanT cell, DCPBermuda grass pollen
Cyn d 1 (154–173)KGSNDHYLALLVKYAAGDGNHumanT cell, DCPBermuda grass pollen
Cyn d 1 (136–155)RRVKCKYPSGTKITFHIEKGHumanT cell, DCPBermuda grass pollen
Cyn d 1 (28–47)SNPRGAAPDDHGGACGYKDVHumanT cell, DCPBermuda grass pollen
Cyn d 1 (82–101)VECSGEPVLVKITDKNYEHIHumanT cell, DCPBermuda grass pollen
Cyn d 1 (227–246)VIPANWKPDTVYTSKLQFGAHumanT cell, DCPBermuda grass pollen
Cyn d 1 (91–110)VKITDKNYEHIAAYHFDLSGHumanT cell, DCPBermuda grass pollen
Cyn d 1 (73–92)CYEIKCKEPVECSGEPVLVKHumanT cell, DCPBermuda grass pollen
Fel d 1 IPC-2KALPVVLENARILKNCVDAKMTEEDKEHumanT cell, LSC, NSCCat allergy
Fel d 1 IPC-1KRDVDLFLTGTPDEYVEQVAQYKALPVHumanT cell, LSC, NSCCat allergy
peptide 4 (P93-110)TKCYKLEHPVTGCGERTEHumanT cell, CLPRHoney bee sting
peptide 1 (P81-98)YFVGKMYFNLIDTKCYKLHumanT cell, CLPRHoney bee sting
Bet v 1SKEMGETLLRAVESYLLAHSDMouseB cell, AWIBirch pollen
Der p 1 111–139FGISNYCQIYPPNANKIREALAQPQRYCRMouseT cell, DTPEuropean HDM
Der p 1 113–127ISNYCQIYPPNANKIMouseT cell, DTPEuropean HDM
Der p I (101–154)QSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDMouseT cell, DTPEuropean HDM
Der p 1 110–131RFGISNYCQIYPPNANKIREALMouseT cell, DTPEuropean HDM
Der p I 114–129SNYCQIYPPNANKIRMouseB cell, DTHEuropean HDM
Der p 2 87–129DIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACAIATHAKIRDMouseB cell, BPR, AWIEuropean HDM
Der p I (98–140)AREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVMouseT cell, DTPEuropean HDM
Api m 4 7–19KVLTTGLPALISWMouseB cell, IgG1Honey bee sting
Dol m 5 176–195IEDNWYTHYLVCNYGPGGNDMouseB cell, IgG1Hornet sting
Dol m 5 41–60KNEILKRHNDFRQNVAKGLEMouseT cell, DTPHornet sting
Dol m 5 141–160NYKVGLQNSNFRKVGHYTQMMouseT cell, DTPHornet sting
Cry j 2 247–258AEVSYVHVNGAKMouseB cell, CSIJapanese cedar pollen
Cry j 2 P2 246–259RAEVSYVHVNGAKFMouseT cell, NSJapanese cedar pollen
Ole 1 109–130TVNGTTRTVNPLGFFKKEALPKMouseB cell, AWIOlive tree pollen
Phl p 5 peptideYAATVATAPEVKYTVFETALKKAIMouseB cell, AWITimothy grass pollen
Phl p 1 peptideLRSAGELELQFRRVKCKYPEGMouseB cell, AWITimothy grass pollen
Bet v 1/Phl p 1/Phl p 5 hybridMGETLLRAVESYAGELELQFRRVKCKYTVATAPEVKYTVFETALKMouseB cell, AWITree/Grass pollen
PI-1 IgECHε2 (109-117)LYCFIYGHIMouseT cell, PCAMouse
nOVA 173–196VLVNAIVFKGLWEKAFKDEDTQAMRatB cell, PCAChicken Egg
OVA (257–264)SIINFEKLMouseT cell, AWIAsthma
OVA (323–339)ISQAVHAAHAEINEAGRMouseT cell, AWIAsthma

HDM: house dust mite. Mouse strains consisted of BALB/c and C57BL/6. Rats were Norway strain. AWI: airway inflammation (histology). NS: nasal symptoms (sneezing and rubbing). CSI: cytokine suppression of allergen-IgE production. BPR: bronchopulmonary resistance. DTH: delayed type hypersensitivity. LSC: lung score. NSC: nasal score. CLPR: cutaneous late-phase reaction. DTP: decrease allergen-specific T cell proliferation. DCP: decreased allergen-specific cytokine production.

We are committed to sharing findings related to COVID-19 as quickly as possible. We will be providing unlimited waivers of publication charges for accepted research articles as well as case reports and case series related to COVID-19. Review articles are excluded from this waiver policy. Sign up here as a reviewer to help fast-track new submissions.