BioMed Research International / 2013 / Article / Tab 2

Research Article

Proteomic Identification of Dengue Virus Binding Proteins in Aedes aegypti Mosquitoes and Aedes albopictus Cells

Table 2

Distinct host peptides identified by mass spectrometry bound to DENV.

Cell/tissue expressionProtein nameExperment numberPeptide identifiedScore

C6/36 (57 kDa)Enolase1K.EALNLIQDAIAK.A45.6
R.GNPTVEVDLVTDLGLFR.A62.1
K.VNQIGTVTESINAHLLAK.K76.1
R.SGETEDTFIADLVVGLSTGQIK.T76.1
C6/36 (67 kDa)2FGLDATAVGDEGGFAPNILNNKEALDLINEAISK60.5
DS33GVLKAVTQ20.2
DMEB (67 kDa)4R.AAVPSGASTGVHEALELR.D 53.2
K.NLILPVPAFNVINGGSHAGNKQAMQEFMILPTGACSFTEAMK.M21.7

DMEB (67 kDa)Beta-adrenergic receptor kinase1 ESQELLGSMAKK40.1
DS3 (67 kDa)2ESQELLGSMAKK40.1
C6/36 (67 kDa)3AKPGAEAHPPFRQHK26.9

C6/36 (57 kDa) Translation elongation factor EF-1 alpha/Tu1SGDAAIVNLVPSWPLCVESFQEFPPLGR82.9
Mori (extract)2NNPPKQAA21.8
IBO3K.GASDFTAQVIVLNHPGQIANGYTPVLDCHTAVIACKFAEIQQK.V
R.LPLQDVYK.I
63

C6/36 (80 kDa)Cadherin1FLIDYGSGTLELRIATK52

Proteomic analysis was performed in protein from C6/36 cells, mosquito MGS purified by affinity chromatography (extract), or in the bands of interest excised after separation by SDS-PAGE.

We are committed to sharing findings related to COVID-19 as quickly as possible. We will be providing unlimited waivers of publication charges for accepted research articles as well as case reports and case series related to COVID-19. Review articles are excluded from this waiver policy. Sign up here as a reviewer to help fast-track new submissions.