Mass Spectrometry Based Proteomic Analysis of Salivary Glands of Urban Malaria Vector Anopheles stephensi
Figure 3
Peak spectrum analyzed by LC/MS/MS based on m/z values. (a) Peptide sequence (LMTYFDYFDSDVSNVLPMQSTDKYFDYAVFAR) with peak at m/z 470 in An. stephensi corresponds to novel protein (hexamerin) of An. gambiae. (b) Peptide sequence (MNFFIKQLAIADLCVGLLNVLTDIIWR) with peak at m/z 638 in An. stephensi corresponds to novel protein (G protein coupled receptor protein) of An. gambiae.
