BioMed Research International / 2014 / Article / Fig 3

Research Article

Mass Spectrometry Based Proteomic Analysis of Salivary Glands of Urban Malaria Vector Anopheles stephensi

Figure 3

Peak spectrum analyzed by LC/MS/MS based on m/z values. (a) Peptide sequence (LMTYFDYFDSDVSNVLPMQSTDKYFDYAVFAR) with peak at m/z 470 in An. stephensi corresponds to novel protein (hexamerin) of An. gambiae. (b) Peptide sequence (MNFFIKQLAIADLCVGLLNVLTDIIWR) with peak at m/z 638 in An. stephensi corresponds to novel protein (G protein coupled receptor protein) of An. gambiae.
686319.fig.003a
(a)
686319.fig.003b
(b)