Review Article
Current and Potential Applications of Host-Defense Peptides and Proteins in Urology
Table 1
Summary of host-defense peptides discussed.
| Peptide name/inducers | Peptide sequence | Current/potential application in urology | References |
| Lactoferrin-derived peptide HLD1 | EATKCFQWQRNMRKVRGPPVSCIKR-NH2 | Oral administration for UTI |
[17] | Lactoferrin-derived peptide HLD2 | TK©FQWQRNMRKVRGPPVS©IKR-NH2 | Tachyplesin III | KWCFRVCYRGICYRKCR-NH2 | Antimicrobial coating for urologic devices | [7] | Tet-20 | KRWRIRVRVIRKC-NH2 | [18] | RK1 (salt-tolerant) | RWKRWWRRKK | [19] | RK2 (salt-tolerant) | RKKRWWRRKK | [19] | Magainin II | GIGKFLHSAKKFGKAFVGEIMNS-NH2 | Target bladder cancer cells | [20–22] | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
[23] | Cecropin B | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 | Peptoids | Most potent one analyzed: H-(Nlys-Nspe-Nspe)4-NH2 | [24] | Human -defensin-1 | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-NH2 | [25–27] | OPN-derived peptides | Many OPN-derived peptides were analyzed; one of the more promising ones being OPN-derived peptide D9: ADAAADDAAADAAADDAA-NH2 | Target kidney stones | [28] |
|
|