Research Article
Experimental Study of Potential CD8+ Trivalent Synthetic Peptides for Liver Cancer Vaccine Development Using Sprague Dawley Rat Models
Table 3
Screening parameters of the predicted T cell epitopes and trivalent construct.
| | Sr. no. | EPITOPE_HLA (target) | Sequence | Antigenicity | M/W (kDa) | Solubility | Immunogenicity | Binding energy (kcal/mol) |
| | 1 | ALB_MHC class I, allele 1 | LLECADDRADLAKY | 1.0188 | 1.59579 | 0.984845 | -0.00437 | -11.3124 | | 2 | BTNL2_MHC class I, allele 1 | VSEHRIQDKDGLFY | 0.5641 | 1.69276 | 0.904257 | 0.23389 | -10.6156 | | 3 | GPC3_MHC class I, allele 1 | EYILSLEELVNGMY | 0.7682 | 1.7159 | 0.833942 | -0.02795 | -8.4656 | | 7 | TRIVALENT_MHC class I, allele 1 | VSEHRIQDKDGLFYAAYLLECADDRADLAKYAAYEYILSLEELVNGMY | 0.6920 | 5.55021 | 0.669752 | -0.63436 | -17.0048 |
|
|
