Immunogenicity and Safety of a Chemically Synthesized Divalent Group A Streptococcal Vaccine

Figure 1

Schematic diagram of the vaccine. The vaccine is a signal peptide composed of 84 amino acids: GFANQTEVKANGDGNPREVIEDLAANNPAIQNIRLDHSDLVAEKQRLEDLGQKFERLKQRSE-LYLQQYYDASREAKKQVEKALE. The first 35 amino acid sequence (GFANQTEVKANGDGNPREVIEDLAANNPAIQNIRL) is from N terminal of M1 protein, the next 35 amino acid sequence (DHSDLVAE KQRLEDLGQKFERLKQRSELYLQQYYD) is from N terminal of M12 protein, and the last 14 amino acid sequence(ASREAKKQVEKALE) is the J14 peptide.