Human Genetic Markers and Structural Prediction of Plasmodium falciparum Multidrug Resistance Gene (pfmdr1) for Ligand Binding in Pregnant Women Attending General Hospital Minna

Table 7

PDBSum database information of pfmdr1 gene homologous protein sequence. Sequence: GTDYFCNLIEKAIDYKNKGQKRRIIVNAALWGFSQSAQLFINSFAYWFGSXLIKRGTILVDDFMKXX. Sequence length: 67 residues.

	PDB; code	Model	Length	%-tage; identity	a.a.; overlap	-score	Ligands	Protein name
1	3wmg(A)	X-ray 2.40 Å	589	27.3%	44	139.8	DMU, TRS.	Crystal structure of an inward-facing eukaryotic ABC multidrug transporter g277v/a278v/a279v mutant in complex with a cyclic peptide inhibitor, aCAP
2	3wmf(A)	X-ray 2.60 Å	588	27.3%	44	139.8	DMU.	Crystal structure of an inward-facing eukaryotic ABC multidrug transporter g277v/a278v/a279v mutant
3	IEMDT(A)	X-ray 2.75 Å	588	27.3%	44	139.8	DMU.	Crystal structure of an inward-facing eukaryotic ABC multidrug transporter
4	4rhs(A)	X-ray 1.92 Å	114	31.7%	41	126.9	ACT, SIA-SIA-GAL.	Crystal structure of GD2 bound pltb
5	SPLTB(A)	X-ray 2.08 Å	114	31.7%	41	126.9	ACT.	Crystal structure of pltb
6	STT(A)	X-ray 2.39 Å	114	31.7%	41	126.9	GOL.	Structure of typhoid toxin
7	5luq(A)	X-ray 4.30 Å	3725	34.8%	46	111.6		Crystal structure of human DNA-dependent protein kinase catalytic subunit (DNA-PKcs)