The Scientific World Journal / 2014 / Article / Tab 3

Research Article

Characterization of Affinity-Purified Isoforms of Acinetobacter calcoaceticus Y1 Glutathione Transferases

Table 3

Protein (FASTA) sequences for F0KLY9 (putative glutathione S-transferase) and F0KKB0 (glutathione S-transferase III) were retrieved from http://www.uniprot.org/uniprot/. Bold and italic is the identified active residue (Y, S, or C at positions 5 or 6) which is present in F0KLY9 (putative glutathione S-transferase) amino acid sequence.

UniProt IdentifiersAmino acid sequences

F0KLY9 MSLKLYTNKESRGVVIDWLLVELGVECERIEVAYKTEMKSPEYLKLN 
PFGKVPVLVDGDVVIYELGAICAYLADKFSDKGLAPALDDPKRGLYYR
WLFLMAGPWEAAGVDKALGIEVSPEQKMFVGYGDYNDAYQALVQGL
SEANPYVCGEQFTAADVSVGAMLLWQLKMNAIESHPAITRYVETIKQR
EGLKQSTMGQLL
F0KKB0MSIILHHLNASRSFRILWLLEEINQPYELKSYFRDKTTNLAPQELKNIHP
LGKSPVIELNGKVIAESGAIVEILIEKFAPQLMPAKDSDSYLDYLQWVH
FSESSAMVPYLLNIFNSIELKNGTQLKFLDQYAHTELDKVFSYLDQQLV
GKKFLVGNSLTGADFMIGFVVYGLINSLNIRSKYLNIEQYVKSLENLES
WQKAMSIEQNLHHQTNA

We are committed to sharing findings related to COVID-19 as quickly as possible. We will be providing unlimited waivers of publication charges for accepted research articles as well as case reports and case series related to COVID-19. Review articles are excluded from this waiver policy. Sign up here as a reviewer to help fast-track new submissions.