A Proteomics Analysis to Evaluate Cytotoxicity in NRK-52E Cells Caused by Unmodified Nano-Fe₃O₄

Table 1

The MS intensities of peptide GVDNTFADELVELSTALEHQEYITFLEDLK labeled H ( 1165.92) and labeled D ( 1168.60) in peak area and peak height.

	Peak area	Peak height	Ratio of area	Ratio of height
1165.92	4084412	1240520	4.42	4.22
1168.60	18036323	5230797