The Scientific World Journal

The Scientific World Journal / 2014 / Article
Special Issue

Toxicology and Disease/Cancer Therapy in Reactive Oxygen Species-Mediated Drugs and Treatments

View this Special Issue

Research Article | Open Access

Volume 2014 |Article ID 754721 | 9 pages | https://doi.org/10.1155/2014/754721

A Proteomics Analysis to Evaluate Cytotoxicity in NRK-52E Cells Caused by Unmodified Nano-Fe3O4

Academic Editor: Hsueh-Wei Chang
Received21 Apr 2014
Accepted05 Jun 2014
Published17 Aug 2014

Abstract

We synthesized unmodified Fe3O4 nanoparticles (NPs) with particles size from 10 nm to 100 nm. We cultured NRK-52E cell lines (rat, kidney) and treated with Fe3O4 NPs to investigate and evaluate the cytotoxicity of NPs for NRK-52E cells. Through global proteomics analysis using dimethyl labeling techniques and liquid phase chromatography coupled with a tandem mass spectrometer (LC-MS/MS), we characterized 435 proteins including the programmed cell death related proteins, ras-related proteins, glutathione related proteins, and the chaperone proteins such as heat shock proteins, serpin H1, protein disulfide-isomerase A4, endoplasmin, and endoplasmic reticulum resident proteins. From the statistical data of identified proteins, we believed that NPs treatment causes cell death and promotes expression of ras-related proteins. In order to avoid apoptosis, NRK-52E cell lines induce a series of protective effects such as glutathione related proteins to reduce reactive oxygen species (ROS), and chaperone proteins to recycle damaged proteins. We suggested that, in the indigenous cellular environment, Fe3O4 NPs treatment induced an antagonistic effect for cell lines to go to which avoids apoptosis.

1. Introduction

In general, nanoparticles (NPs) are a group of particles with diameter size between one nanometer to one hundred nanometers. NPs have properties such as a high specific surface area and have a high potential to be a good catalytic agent, and therefore NPs have been widely used in fields such as antibacterial [1], antimicrobial [2, 3], drug delivery [4], and global use in research [5, 6]. However, having high catalytic potential, NPs were modified with polysaccharide or chitosan to avoid cytotoxicity [2, 3]. Based on the response of toxicity, NPs such as those that use silver and titanium dioxide were evaluated for cytotoxicity, DNA damage, and reactive oxygen species (ROS) [79]. Especially in AgNPs, numerous studies showed that in cellular responses, 100 nm AgNPs induced serine/threonine protein kinase (PAK), phosphatase 2A, and mitogen-activated protein kinase (MAPK) pathways, and 20 nm AgNPs induced ROS, SUMOylation, and protein carbonylation [10]. Moreover, published papers increasingly show that proteomics analysis and LC-MS/MS were utilized to demonstrate the effects of NPs, such as quantitative proteomics to evaluate AgNPs exert cellular responses [10], AgNPs treatment directly involved in ROS, metal detoxification according to genomics and proteomics results [11], and the toxic effects and behavior in Caenorhabditis elegans [12].

Previous studies reported that in vitro experiments and AgNPs exposure directly induced ROS, cell death, apoptosis, and inflammation [13, 14]. In animal model studies, female rats had AgNPs accumulation in kidney regions, especially in the glomerulus [15]. A variety of reports showed evidence that AgNPs treatment has cytotoxicity in proteomics and genomics; however no evaluated studies of other NPs are described with Fe3O4 or gold nanoparticles.

MS-based quantitative proteomics has been developed at a marvelous rate in the past two decades for biomarker discovery and drug screening. In addition, proteomics provides numerous proteins expression profiles using quantitative techniques to estimate and established the relationships using bioinformatics software. Current quantitative comparisons between specimens both with drug treatment and without treatment or normal and abnormal tissues are beneficial to identify the proteins with upregulation or downregulation and to set up biologic mechanisms and pathways [16, 17]. However in complicated tissue specimens, abundant proteins interfere with the detection of rare proteins. Multiple dimensional separation systems were used to fractionate peptides into different fractions through liquid phase chromatography (LC) to decrease the samples’ complication and to increase the amount of protein identification [16, 18].

In this work, we synthesized bare Fe3O4 NPs and characterized the size of NPs by transmission electron microscope (TEM). After treatment with unmodified Fe3O4 NPs, we next utilized dimethyl labeling quantitative reagents to label the tryptic peptides of NRK-52E cell lines with treated and untreated Fe3O4 NPs [19]. In global proteomics research coupled with LC-MS/MS, we demonstrated 435 identified proteins in NRK-52E cell lines by Mascot and simultaneously quantitated 311 proteins through the use of Mascot Distiller bioinformatics software. We classified proteins into chaperone proteins, cell death related and apoptotic proteins, ras-related proteins, and glutathione related proteins. Using STRING for protein-protein interaction [20], we demonstrated the relationships between Fe3O4 NPs and multifarious proteins.

2. Materials and Methods

2.1. Chemical Reagents

Sodium acetate, ferric chloride (FeCl3), ferrous chloride (FeCl2), sodium cyanoborohydride (NaBCNH3), and trifluoroacetic acid (TFA) were obtained from Sigma-Aldrich (St. Louis, MO, USA). Acetonitrile (MeCN) was bought from Merck (Seelze, Germany). Ammonium hydrogen carbonate (NH4HCO3), hydrochloric acid, sodium hydroxide, sodium dodecyl sulphate (SDS), and ethanol were purchased from J. T. Baker (Phillipsburg, NJ, USA). Formaldehyde- solution (20% solution in D2O) was purchased from Isotec Corp. (Miamisburg, OH, USA), while formaldehyde- solution (36.5%–38% in H2O), potassium chloride (KCl), sodium chloride (NaCl), sodium dihydrogen phosphate (NaH2PO4), potassium dihydrogen phosphate (KH2PO4), dimethyl sulfoxide (DMSO), formic acid (FA, 98%–100%), and iodoacetamide (IAM) were purchased from Sigma (St. Louis, MO, USA). Trypsin was purchased from Promega (Madison, WI, USA). The protein concentration of cell lysate was determined by Bradford assay based on the measurement BSA calibration curve (Thermo, Rockford, IL, USA). Deionized H2O with a resistance of 18.2 MΩ was obtained using a Millipore water system.

2.2. Fabrication of Fe3O4 Nanoparticles (NPs) by Hydrothermal Precipitation

The nanoscale magnetic iron oxide particles were prepared by hydrothermal homogeneous coprecipitation [2123]. Ferric chloride (FeCl3, 5.2 g) and ferrous chloride (FeCl2, 2.0 g) were dissolved with sonication in 50 mL clean glassware containing aqueous hydrochloric acid (2 M, 25 mL) at 50°C. Subsequently, the mixture was degassed continuously using a nitrogen gas cylinder. Sodium hydroxide (NaOH 150 mL, 2 M) was slowly injected drop by drop into the glassware. The color of the solution transformed from yellow to orange, and finally the color shifted to black through the NaOH dripping down. After incubation at 50°C for one hour, the supernatant was removed through a strong magnet absorbing NPs. The generated NPs were then washed with deionized water and removed by a centrifugal tube with 1,800 rpm for two minutes. Then finally the NPs were rinsed with 0.5 M HCl, deionized water and ethanol sequentially.

2.3. Characterization of Fe3O4 by Transmission Electron Microscope (TEM)

The size of the synthetic Fe3O4 NPs was characterized by a JEOL JEM 1200-EX transmission electron microscope (TEM) with the accelerating voltage 80 keV. One μL of the nanoparticles solution was dropped on a cupric grid with stabilized carbon, and subsequently the surplus solution evaporated in the atmosphere.

2.4. NRK-52E Cell Culture, the Conditions of Fe3O4 NPs Treatment, and Protein Concentration

The cells, NRK-52E (CRL-1571; American Type Culture Collection, Manassas, VA), were cultured in Dulbecco’s modified Eagle’s medium (DMEM, Sigma-Aldrich) and supplemented with 5% fetal bovine serum (FBS) and 1% penicillin (Gibco, Grand Island, NY, USA). Cells were cultured in a 100 mm dish with a 5% CO2 incubator at 37°C. Until cells reached 80% confluence, they were cultured with the absence of serum medium for 24 hours. After starvation cells were treated with 1 ng Fe3O4 NPs in each dish for 24 hours, and comparison groups were treated with dimethyl sulfoxide (DMSO). After being washed three times with phosphate-buffered saline (PBS), the cells were lysed with modified RIPA buffer containing 1% NP-40, 0.1% SDS, 150 mM NaCl, 50 mM Tris-HCl, and 1 tablet/10 mL of Roche minicomplete protease inhibitor cocktail at pH 7.5. Finally, the protein concentration of NRK-52E cell lysate was determined using the Bradford assay.

2.5. Tryptic Digestion, Dimethyl Labeling, Desalting, and Fractionation

Samples of lysated protein solution 60 μL containing 100 μg of total proteins treated with Fe3O4 NPs and DMSO were reduced by reaction with 0.7 μL of 1 M DTT and 9.3 μL of 7.5% SDS at 95°C for 5 minutes. The sample bottles were put on ice and then for alkylation were treated with 8 μL of 50 mM IAM at room temperature for 30 minutes in the dark with agitation. Furthermore, sample proteins were precipitated by 52 μL of 50% trichloroacetic acid (TCA) with incubation on ice for 15 minutes. By centrifugation to remove the supernatant, the protein pellets were washed in different solutions according to priority with 150 μL of 10% TCA, 250 μL of deionized H2O, 250 μL of acetone, and two times with 250 μL of deionized H2O. After removing the supernatant, the protein pellets were digested in 2 μg of trypsin in 200 μL 50 mM NH4HCO3 (pH 8.5). An additional 2 μg of trypsin was added after 4 hours of tryptic digestion, and then the samples were digested for 14 hours at 37°C. Eventually the tryptic digestion samples were dried by vacuum centrifugation to remove the digested buffer. For labeling procedures, the lyophilized samples were redissolved in 180 μL of 100 mM sodium acetate buffer at pH 5.5. Simultaneously the treated NPs samples were labeled using 10 μL of 4% formaldehyde- and then those samples treated DMSO were labeled using 10 μL of 4% formaldehyde-. Both of the samples were vortexed for 5 minutes, followed by treatment with 10 μL of 600 mM sodium cyanoborohydride for 1 hour. Finally, the labeled solutions were combined after adjusting to pH 2-3 using 10% TFA/H2O for desalting by a homemade C18 cartridge desalting kit. After vacuum centrifugation drying, the triplicate combined samples were fractionated with a hydrophilic interaction chromatography (HILIC) separated system. HILIC system was performed using an L-7100 pump system (Hitachi, Tokyo, Japan) connecting a TSK gel Amide-80 HILIC column (2.0 mm × 150 mm, 3 μm particle size; Tosoh Biosciences, Tokyo, Japan) with a flow rate of 200 μL/min. The mobile phase system was used for gradient elution: solvent (A) was 0.1% TFA in water; solvent (B) was 0.1% TFA in 100% MeCN. The eluted fraction from the homemade C18 cartridge was dissolved in 25 μL of solution containing 85% MeCN and 0.1% TFA and then injected into the 20 μL sample loop. Furthermore, the gradient was performed as follows: 95% (B) for 2 minutes; 95%~60% (B) for 32 minutes; 60%~5% (B) for 10 minutes; 5% (B) for 5 minutes; 5%~95% (B) for 1 minute; and 95% (B) for 10 minutes. Each fraction contained 1.2 mL buffer in the total of 10 collected fractions, and finally every fraction was dried in a vacuum centrifuged system.

2.6. Protein Identification by LC-MS/MS Analysis

The vacuum dried lyophilized samples were redissolved in 10 μL of 0.1% FA in H2O and analyzed using a Thermo LTQ Orbitrap XL (Thermo Fisher Scientific, San Jose, CA). A total of 10 μL of sample was injected onto a C18 capillary pretrapped column (0.3 mm × 5 mm, 5 μm particle size, Agilent Zorbax XDB); HPLC loading pump and separation was performed by a C18 column (i.d. 75 μm × 150 mm, 3 μm particle size, Micro Tech, Fontana, CA). A LC-MS/MS separation was performed using an Agilent 1200 series Nanoflow pump (Agilent Technologies, Santa Clara, CA). The flow rate of loading pump was set at 5 μL/min, and the gradient pump was set at 300 nL/min. The mobile phases consisted of (A) 0.1% FA in water and (B) 0.1% FA in 100% MeCN. The linear gradient was as follows: 2% (B) in 2 minutes, 2%~40% (B) in 40 minutes, 40%~95% (B) in 8 minutes, 95% (B) in 2 minutes, 95%~2% (B) in 1 minute, and 2% (B) in 7 minutes. The digested peptides were detected by a voltage of 1.8 kV in the positive detection ion mode. The separated system with full scanning mode conditions was set at 400–1600 Da with resolution = 30,000. The data-dependent mode was set according to a priority to select peptides which were detected with 5 high-intensity signals in the MS mode and transferred into collision chamber for fragmentation with a collision energy of 35 eV. The fragmented ions were analyzed and detected at second MS analyzer with a mass range of 100–2000 Da. To exclude ions with similar and avoid interferences, the data-dependent mode was also set a repeat duration of 30 seconds.

2.7. Mascot Database Search and Mascot Distiller Quantitation

The software Xcalibur (version 2.0.7, Thermo Scientific Inc., San Jose, CA) was utilized to control Orbitrap XL and to acquire the MS and fragmentation data. The raw data including MS and MS/MS spectra were converted to a suitable file type by the Mascot Distiller software (version 2.5.1.0 (64 bits), Matrix Science Ltd., London, UK) to perform protein identification and quantitation. The parameters of the Mascot Distiller were set as follows: “Orbitrap_res_MS2” (default parameter setting) for peak list transformation; “Rattus” for the taxonomy in the Swiss-Prot databank of the Mascot search engine; zero allowable missed cleavages for tryptic digestion; dimethylation (MD) for quantitation; fixed modification was selected carbamidomethyl for cysteine modification; peptide tolerance of 10 ppm with precursor ions; and 0.8 Da tolerance for MS/MS. Peptides charge was selected when they had charges of 1+, 2+, and 3+, and the instrument was set to “ESI-trap.” Finally, the protein quantitative result was listed by the heavy-labeled/light-labeled (D/H) ratios from the Mascot Distiller.

3. Results and Discussion

3.1. Fe3O4 NPs Synthesis and Characterization

Bare and unmodified Fe3O4 NPs were synthesized by hydrothermal precipitation and NPs were fabricated by chemical method to have a uniform particle size. In Figure 1, TEM images showed that we took three photos of Fe3O4 NPs with 20 nm, 50 nm, and 100 nm scale bars. It is considered that NPs with a higher surface area are easier to aggregate with other NPs; therefore through the aggregation in Fe3O4 NPs there were Fe3O4 particles generated above 100 nm if no additional protective agent was modified onto Fe3O4 (Figure 1(c)). We considered that Fe3O4 NPs with dispersive diameter sizes are suitable for cytotoxicity evaluation due to the fact that NPs found in the environment have random sizes.

3.2. Schematic Representation of Samples Pretreatments, Fractionation, Protein Identification, and Protein Quantitation

For protein quantitation, the procedures and using reagents including formaldehyde-, formaldehyde-, and sodium cyanoborohydride (NaBCNH3) were obeyed as following the previous literature [19]. By utilization of dimethyl labeling, the differences of protein expressions in treatment with and without NPs was enabled to be determined. In the mass spectrum, the proteins of NRK-52E treated NPs were labeled as formaldehyde- and proteins of untreated NPs were labeled as formaldehyde-. In the same sequential peptides, however, different treatments had a mass difference 4 Da or 8 Da depending on the use of the labeling agent. Off-line HILIC fractionation was utilized to decrease the complication of the mixed samples [16, 18]. Through LC-MS/MS, the proteins identification and quantitative ratios of D/H peptides were identified and calculated using the bioinformatic Mascot Distiller software to finally generate a protein list. The schematic flow chart of the process is shown in Figure 2 from sample pretreatment and protein identification to protein quantitation.

3.3. Quantitative Results of NRK-52E Proteins Associated with Fe3O4 NPs

From the statistical results we identified 435 proteins, of which 311 proteins have a D/H ratio and 124 proteins which we were unable to specific values. For example, complement component 1 Q subcomponent-binding protein (C1qBP) was identified with an arithmetic average D/H ratio of 4.23. Figure 3 showed the peptide belonging to C1qBP having sequences GVDNTFADELVELSTALEHQEYITFLEDLK which was fragmentized by collision induced dissociation (CID), and its MS/MS spectrum was illustrated by y-ions and b-ions. From a quantitative standpoint in support of the Mascot Distiller in bioinformatics software, the result of protein list showed that the D/H ratio belonging to GVDNTFADELVELSTALEHQEYITFLEDLK peptide was 4.23. Simultaneously the raw data from LC-MS/MS that we extracted from the labeled peptide of C1qBP by 1165.92 (3+, H-labeled) and 1168.60 (3+, D-labeled) presented signals of peak area and peak height (Figure 4(a)) and showed the isotope pattern of H-labeled peptide and D-labeled peptide (Figure 4(b)) which demonstrated the changes in different labeling. The statistical results showed that peak area was 4.42-fold in D/H ratio and peak height was 4.22-fold; the statistical data was calculated and shown in Table 1.


Peak areaPeak heightRatio of areaRatio of height

1165.92408441212405204.424.22
1168.60180363235230797

3.4. Differentially Expressed Proteins of NRK-52E by Treatment with Fe3O4 NPs

In this study, we used Fe3O4 NPs to treat NRK-52E and used bioinformatics software to generate proteins identification and proteins quantitation with a protein list (the protein list is shown in the electronic supplementary information available online in the Supplementary Materials at http://dx.doi.org/10.1155/2014/754721). In the protein list, we observed that when Fe3O4 NPs were treated, ras-related proteins were expressed including ras-related protein Rab-7L1 (RAB7L_RAT, 3.2-folds), ras-related protein Rab-1A (RAB1A_RAT, 2.3-folds), ras-related protein Rab-2A (RAB2A_RAT, 1.6-folds), ras-related C3 botulinum toxin substrate 1 (RAC1_RAT, 1.2-folds), ras-related protein Rap-1A (RAP1A_RAT), and ras-related protein Rab-7a (RAB7A_RAT). According to previous studies, ras-related proteins were associated with cancer cell metastasis [24, 25], and ras-related C3 botulinum toxin substrate 1 was associated with differential roles such as cell proliferation which could be inhibited by miR-101 [26] and signal transduction to upregulate in esophageal squamous cell carcinoma and esophageal adenocarcinoma [27].

We also identified related proteins in cell death and apoptosis, such as apoptotic protease-activating factor 1 (APAF_RAT, 780.9-folds), programmed cell death protein 10 (PDC10_RAT, 233.2-folds), galectin-1 (LEG1_RAT, 1.75-folds), and programmed cell death 6-interacting protein (PDC6I_RAT). Apoptotic protease-activating factor 1 activated procaspase-9 and modulated cellular apoptosis [28]. However, programmed cell death protein 10 promotes cell proliferation and protects malignant T cells from apoptosis [29]. The galectin family played different roles in cell apoptosis such as galectin-7 enhancing apoptosis, but galectin-1 has the opposite effect [30]. In accordance with previous studies and the proteins quantitative list, we considered that the treatment of Fe3O4 NPs caused an antagonistic effect. Fe3O4 NPs induced expression of ras-related proteins and induced programmed cell death protein 10, galectin 1 to promote cell metastasis, proliferation, and progression. However, the apoptotic protease-activating factor 1 promoted cell to go to apoptosis.

A variety of glutathione-related proteins with high expression were identified, such as glutathione reductase (Fragment), glutathione S-transferase Mu 1, glutathione S-transferase Mu 2, glutathione S-transferase P, and glutathione S-transferase alpha-3. We thought that Fe3O4 NPs induced reactive oxygen species (ROS) to cause overexpression of glutathione-related proteins. After one day of Fe3O4 NPs treatment, a strong magnet was utilized to recover the residual NPs, but there were no NPs to be recycled. We considered that the NPs had transferred into ferric ions (Fe3+) and ferrous ions (Fe2+) and that endogenous hydrogen peroxide (H2O2) reacted with ferrous ions to compose hydroxide free radicals (Fenton reaction) [31, 32]. A variety of reports show that ROS effects are exhibited when NPs were treated [7, 14]. However, ferrous ion (Fe2+) is an initiator in the Fenton reaction, and ferrous ions will react with hydrogen peroxide to produce hydroxide free radicals.

3.5. Chaperone Proteins Overexpression and STRING Networks Establishment

We also characterized chaperone proteins such as heat shock proteins, serpin H1, protein disulfide-isomerase, endoplasmin, and endoplasmic reticulum resident protein.

Eventually, we used the STRING (vision 9.1, http://string-db.org/) database to establish the interactions between chaperone proteins and related proteins to demonstrate the relationships between Fe3O4 NPs and the associated proteins [20]. The relationships between chaperone proteins, ras-related proteins, glutathione related proteins, and cell death and apoptosis related proteins are listed in Table 2 and illustrated by STRING in Figure 5. Heat shock proteins connected with each other and related ras-related C3 botulinum toxin substrate 1 and then combined to glutathione related proteins.


UNIPROT accessionaUNIPROT accession
numbera
Protein identificationMolecular mass (kDa)bNumber of peptidesbRatioc

Cell death and apoptosis related proteins
APAF_RATQ9EPV5Apoptotic protease-activating factor 1146.12780.9
PDC10_RATQ6NX65Programmed cell death protein 1025.02233.2
LEG1_RATP11762Galectin-115.551.75
PDC6I_RATQ9QZA2Programmed cell death 6-interacting protein99.2n.d.n.d.

Ras-related proteins
RAB7L_RATQ63481Ras-related protein Rab-7L123.723.2
RAB1A_RATQ6NYB7Ras-related protein Rab-1A23.4132.3
RAB2A_RATP05712Ras-related protein Rab-2A24.131.6
RAC1_RATQ6RUV5Ras-related C3 botulinum toxin substrate 122.421.2
RAP1A_RATP62836Ras-related protein Rap-1A21.8n.d.n.d.
RAB7A_RATP09527Ras-related protein Rab-7a24.3n.d.n.d.

Glutathione related proteins
GSHR_RATP70619Glutathione reductase (Fragment)47.823.1
GSTM1_RATP04905Glutathione S-transferase Mu 126.722.8
GSTM2_RATP08010Glutathione S-transferase Mu 226.532.4
GSTP1_RATP04906Glutathione S-transferase P24.161.5
GSTA3_RATP04904Glutathione S-transferase alpha-325.941.2

Chaperone proteins
HSBP1_RATQ8K3X8Heat shock factor-binding protein 18.722.8
HS90B_RATP34058Heat shock protein HSP 90-beta86.0322.7
SERPH_RATP29457Serpin H147.7302.5
HS90A_RATP82995Heat shock protein HSP 90-alpha87.7312.4
HSP74_RATO88600Heat shock 70 kDa protein 497.022.2
HSP7C_RATP63018Heat shock cognate 71 kDa protein72.8401.9
PDIA4_RATP38659Protein disulfide-isomerase A475.191.8
CH60_RATP6303960 kDa heat shock protein, mitochondrial62.6291.6
CH10_RATP2677210 kDa heat shock protein, mitochondrial11.231.6
GRP78_RATP0646178 kDa glucose-regulated protein74.4191.6
ENPL_RATQ66HD0Endoplasmin95.4171.6
PDIA1_RATP04785Protein disulfide-isomerase59.1241.6
ERP29_RATP52555Endoplasmic reticulum resident protein 2929.331.6
PDIA6_RATQ63081Protein disulfide-isomerase A649.641.5
PDIA3_RATP11598Protein disulfide-isomerase A358.6171.3

aProtein accession and protein accession number were received from the UNIPROT database available online: http://www.uniprot.org/uniprot (accessed on May 25, 2014).
bMolecular weight and number of protein peptides according to the Swiss-Prot database in the Mascot search engine.
cRatio values of each protein according to protein list in the Mascot Distiller.

4. Conclusion

This is a pioneer experiment to show the cellular responses through Fe3O4 NPs treatment. We hypothesized an antagonistic effect in NRK-52E cell lines which is presented as cell death, apoptosis, and cancerization via programmed cell death protein and ras-related proteins; however there are protective mechanism proteins in NRK-52E such as chaperone proteins and glutathione related proteins. In future work, we shall generate or purchase Fe3O4 NPs in a smaller size to confirm the size effect of NPs, and we also need more evidence to prove the ROS effect induced via ferrous ions and to explain the tendency towards apoptosis or to avoid cell death.

Conflict of Interests

The all authors declare that they have no conflict of interests in this study.

Acknowledgments

This work was supported by a grant from the Kaohsiung Medical University Research Foundation (KMU-Q110023), with cooperation between the National Sun Yat-Sen University and Kaohsiung Medical University (NSYSUKMU 103-P010) and the National Science Council (NSC 102-2113-M-037-013-MY2), Taipei, Taiwan. The authors are thankful for the assistance of the Center for Resources, Research and Development of Kaohsiung Medical University.

Supplementary Materials

The supplementary information is the raw data generated all proteins in quantitative proteomics which are listed according to the D/H ratio priority.

  1. Supplementary Materials

References

  1. C. You, C. Han, X. Wang et al., “The progress of silver nanoparticles in the antibacterial mechanism, clinical application and cytotoxicity,” Molecular Biology Reports, vol. 39, no. 9, pp. 9193–9201, 2012. View at: Publisher Site | Google Scholar
  2. A. Travan, C. Pelillo, I. Donati et al., “Non-cytotoxic silver nanoparticle-polysaccharide nanocomposites with antimicrobial activity,” Biomacromolecules, vol. 10, no. 6, pp. 1429–1435, 2009. View at: Publisher Site | Google Scholar
  3. T. V. Mathew and S. Kuriakose, “Photochemical and antimicrobial properties of silver nanoparticle- encapsulated chitosan functionalized with photoactive groups,” Materials Science and Engineering C, vol. 33, no. 7, pp. 4409–4415, 2013. View at: Publisher Site | Google Scholar
  4. W. Ding and L. Guo, “Immobilized transferrin Fe3O4@SiO2 nanoparticle with high doxorubicin loading for dual-targeted tumor drug delivery,” International Journal of Nanomedicine, vol. 8, no. 1, pp. 4631–4639, 2013. View at: Publisher Site | Google Scholar
  5. H. Zhang, K. E. Burnum, M. L. Luna et al., “Quantitative proteomics analysis of adsorbed plasma proteins classifies nanoparticles with different surface properties and size,” Proteomics, vol. 11, no. 23, pp. 4569–4577, 2011. View at: Publisher Site | Google Scholar
  6. D. Simberg, J. Park, P. P. Karmali et al., “Differential proteomics analysis of the surface heterogeneity of dextran iron oxide nanoparticles and the implications for their in vivo clearance,” Biomaterials, vol. 30, no. 23-24, pp. 3926–3933, 2009. View at: Publisher Site | Google Scholar
  7. M. Faria, J. M. Navas, A. M. Soares, and C. Barata, “Oxidative stress effects of titanium dioxide nanoparticle aggregates in zebrafish embryos,” Science of the Total Environment, vol. 470-471, pp. 379–389, 2014. View at: Google Scholar
  8. B. Trouiller, R. Reliene, A. Westbrook, P. Solaimani, and R. H. Schiestl, “Titanium dioxide nanoparticles induce DNA damage and genetic instability in vivo in mice,” Cancer Research, vol. 69, no. 22, pp. 8784–8789, 2009. View at: Publisher Site | Google Scholar
  9. P. Das, M. A. Xenopoulos, and C. D. Metcalfe, “Toxicity of silver and titanium dioxide nanoparticle suspensions to the aquatic invertebrate, Daphnia magna,” Bulletin of Environmental Contamination and Toxicology, vol. 91, no. 1, pp. 76–82, 2013. View at: Publisher Site | Google Scholar
  10. T. Verano-Braga, R. Miethling-Graff, K. Wojdyla et al., Insights into the Cellular Response Triggered by Silver Nanoparticles Using Quantitative Proteomics, ACS Nano, 2014.
  11. F. Mirzajani, H. Askari, S. Hamzelou et al., “Proteomics study of silver nanoparticles toxicity on Bacillus thuringiensis,” Ecotoxicology and Environmental Safety, vol. 100, pp. 122–130, 2014. View at: Google Scholar
  12. X. Yang, C. Jiang, H. Hsu-Kim et al., “Silver nanoparticle behavior, uptake, and toxicity in Caenorhabditis elegans: effects of natural organic matter,” Environmental Science & Technology, vol. 48, no. 6, pp. 3486–3495, 2014. View at: Google Scholar
  13. P. V. AshaRani, G. L. K. Mun, M. P. Hande, and S. Valiyaveettil, “Cytotoxicity and genotoxicity of silver nanoparticles in human cells,” ACS Nano, vol. 3, no. 2, pp. 279–290, 2009. View at: Publisher Site | Google Scholar
  14. R. P. Singh and P. Ramarao, “Cellular uptake, intracellular trafficking and cytotoxicity of silver nanoparticles,” Toxicology Letters, vol. 213, no. 2, pp. 249–259, 2012. View at: Publisher Site | Google Scholar
  15. W. Kim, J. Kim, J. D. Park, H. Y. Ryu, and I. J. Yu, “Histological study of gender differences in accumulation of silver nanoparticles in kidneys of Fischer 344 rats,” Journal of Toxicology and Environmental Health A, vol. 72, no. 21-22, pp. 1279–1284, 2009. View at: Publisher Site | Google Scholar
  16. C.-J. Kuo, S.-S. Liang, E. Hsi, S.-H. Chiou, and S.-D. Lin, “Quantitative proteomics analysis of varicose veins: Identification of a set of differentially expressed proteins related to ATP generation and utilization,” Kaohsiung Journal of Medical Sciences, vol. 29, no. 11, pp. 594–605, 2013. View at: Publisher Site | Google Scholar
  17. M. F. Ellias, S. H. Z. Ariffin, S. A. Karsani, M. A. Rahman, S. Senafi, and R. M. A. Wahab, “Proteomic analysis of saliva identifies potential biomarkers for orthodontic tooth movement,” The Scientific World Journal, vol. 2012, Article ID 647240, 6 pages, 2012. View at: Publisher Site | Google Scholar
  18. S. B. Ficarro, Y. Zhang, M. J. Carrasco-Alfonso et al., “Online nanoflow multidimensional fractionation for high efficiency phosphopeptide analysis,” Molecular & Cellular Proteomics, vol. 10, no. 11, Article ID O111.011064, 2011. View at: Publisher Site | Google Scholar
  19. J. Hsu, S. Huang, N. Chow, and S. Chen, “Stable-isotope dimethyl labeling for quantitative proteomics,” Analytical Chemistry, vol. 75, no. 24, pp. 6843–6852, 2003. View at: Publisher Site | Google Scholar
  20. A. Franceschini, D. Szklarczyk, S. Frankild et al., “STRING v9.1: protein-protein interaction networks, with increased coverage and integration,” Nucleic Acids Research, vol. 41, no. 1, pp. D808–D815, 2013. View at: Publisher Site | Google Scholar
  21. W.-Y. Chen and Y.-C. Chen, “Functional Fe3O4@ZnO magnetic nanoparticle-assisted enrichment and enzymatic digestion of phosphoproteins from saliva,” Analytical and Bioanalytical Chemistry, vol. 398, no. 5, pp. 2049–2057, 2010. View at: Publisher Site | Google Scholar
  22. H. Lin, W. Chen, and Y. Chen, “Iron oxide/tantalum oxide core-shell magnetic nanoparticle-based microwave-assisted extraction for phosphopeptide enrichment from complex samples for MALDI MS analysis,” Analytical and Bioanalytical Chemistry, vol. 394, no. 8, pp. 2129–2136, 2009. View at: Publisher Site | Google Scholar
  23. K. Woo, J. Hong, S. Choi et al., “Easy synthesis and magnetic properties of iron oxide nanoparticles,” Chemistry of Materials, vol. 16, no. 14, pp. 2814–2818, 2004. View at: Publisher Site | Google Scholar
  24. Y. X. Yin, F. Shen, H. Pei et al., “Increased expression of Rab25 in breast cancer correlates with lymphatic metastasis,” Tumor Biology, vol. 33, no. 5, pp. 1581–1587, 2012. View at: Publisher Site | Google Scholar
  25. H. C. Adams III, R. Chen, Z. Liu, and I. P. Whitehead, “Regulation of breast cancer cell motility by T-cell lymphoma invasion and metastasis-inducing protein,” Breast Cancer Research, vol. 12, no. 5, article R69, 2010. View at: Publisher Site | Google Scholar
  26. X. Lin, H. Guan, H. Li et al., “miR-101 inhibits cell proliferation by targeting Rac1 in papillary thyroid carcinoma,” Bioscience Reports, vol. 2, no. 1, pp. 122–126, 2014. View at: Google Scholar
  27. M. Bashir, D. Kirmani, H. F. Bhat et al., “P66shc and its downstream Eps8 and Rac1 proteins are upregulated in esophageal cancers,” Cell Communication and Signaling, vol. 8, article 13, 2010. View at: Publisher Site | Google Scholar
  28. L. Mondragón, M. Orzáez, G. Sanclimens et al., “Modulation of cellular apoptosis with apoptotic protease-activating factor 1 (Apaf-1) inhibitors,” Journal of Medicinal Chemistry, vol. 51, no. 3, pp. 521–529, 2008. View at: Publisher Site | Google Scholar
  29. B. Lauenborg, K. Kopp, T. Krejsgaard et al., “Programmed cell death-10 enhances proliferation and protects malignant T cells from apoptosis,” APMIS, vol. 118, no. 10, pp. 719–728, 2010. View at: Publisher Site | Google Scholar
  30. B. Barkan, A. D. Cox, and Y. Kloog, “Ras inhibition boosts galectin-7 at the expense of galectin-1 to sensitize cells to apoptosis,” Oncotarget, vol. 4, no. 2, pp. 256–268, 2013. View at: Google Scholar
  31. E. W. Iyamu, H. Perdew, and G. M. Woods, “Cysteine-iron promotes arginase activity by driving the Fenton reaction,” Biochemical and Biophysical Research Communications, vol. 376, no. 1, pp. 116–120, 2008. View at: Publisher Site | Google Scholar
  32. S. Toyokuni, “Iron and carcinogenesis: from Fenton reaction to target genes,” Redox Report, vol. 7, no. 4, pp. 189–197, 2002. View at: Publisher Site | Google Scholar

Copyright © 2014 Yi-Reng Lin et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

1238 Views | 498 Downloads | 9 Citations
 PDF  Download Citation  Citation
 Download other formatsMore
 Order printed copiesOrder

We are committed to sharing findings related to COVID-19 as quickly and safely as possible. Any author submitting a COVID-19 paper should notify us at help@hindawi.com to ensure their research is fast-tracked and made available on a preprint server as soon as possible. We will be providing unlimited waivers of publication charges for accepted articles related to COVID-19.